PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_30834_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HB-other
Protein Properties Length: 640aa    MW: 71790.2 Da    PI: 8.7772
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_30834_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.78e-08100156157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     +r+R  ++++ l+ ++e+F  +  +s++e +e++++ g+t +qVk +F  +R + +k
  Neem_30834_f_1 100 KRPRDLLNPKALKYMQEVFSVKDAISKRESREISAQFGVTVTQVKDFFASQRSRVRK 156
                     799**************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.38297157IPR001356Homeobox domain
SMARTSM003892.1E-499161IPR001356Homeobox domain
PfamPF000462.9E-5100156IPR001356Homeobox domain
SuperFamilySSF466892.91E-7100160IPR009057Homeodomain-like
CDDcd000862.33E-5100156No hitNo description
Gene3DG3DSA:1.10.10.603.8E-7100166IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 640 aa     Download sequence    Send to blast
MSGLYRSRTS SFELDNGGVE EEFFGDGDWE FGGIVSEVSG FAERAFPQPD RAAPKRCCHT  60
MQTNWSQSSF ARNALGFLLM CSDGFPFNKA AGALSIKIGK RPRDLLNPKA LKYMQEVFSV  120
KDAISKRESR EISAQFGVTV TQVKDFFASQ RSRVRKLVRL SREKAIKSNA CKEPQSDVVR  180
IISDSMIPID PVPLSSAGPT SVIPIDHLPL NSIGSLNVEE EPSCSGQDDS LVGIDDLDKH  240
FVENIFSLMR REETFSGQVK LMEWILQIEN SSVLFWFLTK GGVMILATWM SQAADEEQTS  300
VLSVILDVYS HLPLHKAFPE QMSAILQSVK RLRFYRASDL TNRARILLSK WSKLFARSQA  360
LKKPNGTKSC TDSENELILK QRQVLVFFFC LYLQDFFKLF LIVALYTWCS IGEIMADESW  420
QSNNNVSEAS LASSYESSEN LRKLESPQPL KLLTASSDDS ARKNILGASS SLTDNRERRK  480
VQFVEQPGQK MPGRSPQAAR AAPVSQARPM SADDIQKAKL RAMHMQNKYG KMGSSSNGSN  540
EVKTEGLNKL TTTQASIVLP ESKALVRPQI EEHKKAEMVQ SKISCKLESP LDSKQKMDIK  600
VPPEKCNRVL IRWQTPPDYK FVLPFVMNSE LPYGIPDLEI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006444261.10.0hypothetical protein CICLE_v100186172mg, partial
RefseqXP_015386303.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
SwissprotQ387961e-141LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A067HH030.0A0A067HH03_CITSI; Uncharacterized protein
TrEMBLV4U5P20.0V4U5P2_9R
STRINGPOPTR_0002s20990.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM108762428
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-130HB-other family protein